SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122796 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122796
Domain Number 1 Region: 23-190
Classification Level Classification E-value
Superfamily ARM repeat 7.85e-41
Family Clathrin adaptor core protein 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122796   Gene: ENSMUSG00000040701   Transcript: ENSMUST00000151314
Sequence length 235
Comment pep:known chromosome:GRCm38:14:55098578:55106534:-1 gene:ENSMUSG00000040701 transcript:ENSMUST00000151314 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVVHSLRLQDLIEEIRGAKTQAQEREVIQKECAQIRASFRDGDPLQRHRQLAKLLYVHML
GYPAHFGQMECLKLIASPRFTDKRVGYLGAMLLLDERHDSHLLITNSIKNDLSQGNQPVQ
GLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKDPELSGIFLPPC
TKLLRERHHGSAAAGTDPPDSGDYRILHGAQHLWSQRPLLAGPDTPPTSDPGTEP
Download sequence
Identical sequences D6RFT7
ENSMUSP00000115441 ENSMUSP00000116698 ENSMUSP00000122796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]