SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122915 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122915
Domain Number 1 Region: 91-317
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-44
Family Voltage-gated potassium channels 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122915   Gene: ENSMUSG00000016346   Transcript: ENSMUST00000149964
Sequence length 870
Comment pep:known chromosome:GRCm38:2:181075579:181135103:-1 gene:ENSMUSG00000016346 transcript:ENSMUST00000149964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSVLSKPRTG
GAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTW
QYYERTVTVPMYSSQTQTYGASRLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPSKGRP
CRGCLCGCCPGHSSQKVSLKDRVFSSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKV
PKSWSFGDRSRTRQAFRIKGAASRQNSEEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVS
IRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPTI
TDKDRTKGPAETELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIPPAETEAYF
GAKEPEPAPPYHSPEDSRDHADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQ
QSHQRHGTSPVGDHGSLVRIPPPPAHERSLSAYGGGNRASTEFLRLEGTPACRPSEAALR
DSDTSISIPSVDHEELERSFSGFSISQSKENLDALGSCYAAVAPCAKVRPYIAEGESDTD
SDLCTPCGPPPRSATGEGPFGDVAWAGPRK
Download sequence
Identical sequences B7ZBV9
NP_034741.2.92730 ENSMUSP00000122915 ENSMUSP00000080243 10090.ENSMUSP00000122915 ENSMUSP00000122915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]