SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000122971 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000122971
Domain Number 1 Region: 35-216
Classification Level Classification E-value
Superfamily ARM repeat 4.53e-31
Family Clathrin adaptor core protein 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000122971   Gene: ENSMUSG00000025607   Transcript: ENSMUST00000133916
Sequence length 232
Comment pep:putative chromosome:GRCm38:6:30858803:30896426:-1 gene:ENSMUSG00000025607 transcript:ENSMUST00000133916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRAGPPWGPVGGRGGARASLGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKIL
YLLNQGEHFGTMEATEAFFAMTRLFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKD
MTGKEDVYRGPAIRALCRITDGTMLQAVERYMKQAIVDKVSSVASSALVSSLHMMKISYD
VVKRWINEAQEAASSDNIMVQYHALGVLYHLRKNDRLAVSKMLNKFTKSGLK
Download sequence
Identical sequences ENSMUSP00000122971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]