SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123362 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123362
Domain Number 1 Region: 431-733
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.48e-71
Family Protein kinases, catalytic subunit 0.000000409
Further Details:      
 
Domain Number 2 Region: 268-386
Classification Level Classification E-value
Superfamily Kringle-like 1.79e-34
Family Kringle modules 0.0003
Further Details:      
 
Domain Number 3 Region: 56-144
Classification Level Classification E-value
Superfamily Immunoglobulin 9.09e-22
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000123362
Domain Number - Region: 162-249
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0445
Family Frizzled cysteine-rich domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123362   Gene: ENSMUSG00000021464   Transcript: ENSMUST00000130235
Sequence length 932
Comment pep:putative chromosome:GRCm38:13:53109312:53285549:-1 gene:ENSMUSG00000021464 transcript:ENSMUST00000130235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTGRRALCDPRPGLHRFFPGEVEDSEAIDTLGQPDGPDSPLPTLKGYFLNFLEPVNNIT
IVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRVIIRKTEYGSRLRIQDLDTTDTGY
YQCVATNGLKTITATGVLYVRLGPTHSPNHNFQDDDQEDGFCQPYRGIACARFIGNRTIY
VDSLQMQGEIENRITAAFTMIGTSTQLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELC
RDECEVLENDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIGIPAERLGR
YHQCYNGSGADYRGMASTTKSGHQCQPWALQHPHSHRLSSTEFPELGGGHAYCRNPGGQV
EGPWCFTQNKNVRVELCDVPPCSPRDGSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQ
KASASTPQRRQLMASPSQDMEMPLISQHKQAKLKEISLSTVRFMEELGEDRFGKVYKGHL
FGPAPGEPTQAVAIKTLKDKAEGPLREEFRQEAMLRARLQHPNIVCLLGVVTKDQPLSMI
FSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHVVAQIAAGMEFLSSHHVV
HKDLATRNVLVYDKLNVRISDLGLFREVYSADYYKLMGNSLLPIRWMSPEAVMYGKFSID
SDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRSRQVLPCPDDCPAWVYALMIECWNEF
PSRRPRFKDIHSRLRSWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSNVSNARYMAPKQK
AQPFPQPQFIPMKGQIRPLVPPAQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVP
PQMVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTEDAQNIAEDVAQSPVQEA
EEEEEGSVPETELLGDNDTLQVTEAAHVQLEA
Download sequence
Identical sequences E9PUN5
ENSMUSP00000123362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]