SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123545 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123545
Domain Number 1 Region: 33-185
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-42
Family ALDH-like 0.0000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123545   Gene: ENSMUSG00000029455   Transcript: ENSMUST00000152945
Sequence length 185
Comment pep:novel chromosome:GRCm38:5:121576457:121593582:-1 gene:ENSMUSG00000029455 transcript:ENSMUST00000152945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAALTTVRRGPRLSRLLSAAATSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVN
PSTGEVICQVAEGNKDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYL
AALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVC
GQIIP
Download sequence
Identical sequences D3YYF3
ENSMUSP00000123545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]