SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123552 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000123552
Domain Number 1 Region: 1003-1134
Classification Level Classification E-value
Superfamily CalX-like 3.4e-29
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily CalX-like 1.83e-26
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 3 Region: 406-552
Classification Level Classification E-value
Superfamily CalX-like 6.93e-22
Family CalX-beta domain 0.0038
Further Details:      
 
Domain Number 4 Region: 775-927
Classification Level Classification E-value
Superfamily CalX-like 1.02e-21
Family CalX-beta domain 0.0061
Further Details:      
 
Domain Number 5 Region: 259-398
Classification Level Classification E-value
Superfamily CalX-like 4.71e-19
Family CalX-beta domain 0.0042
Further Details:      
 
Domain Number 6 Region: 907-1004
Classification Level Classification E-value
Superfamily CalX-like 7.98e-18
Family CalX-beta domain 0.007
Further Details:      
 
Domain Number 7 Region: 1118-1213
Classification Level Classification E-value
Superfamily CalX-like 8.5e-18
Family CalX-beta domain 0.0029
Further Details:      
 
Domain Number 8 Region: 668-804
Classification Level Classification E-value
Superfamily CalX-like 1.57e-17
Family CalX-beta domain 0.0074
Further Details:      
 
Domain Number 9 Region: 37-158
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000392
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 10 Region: 517-631
Classification Level Classification E-value
Superfamily CalX-like 0.000000157
Family CalX-beta domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123552   Gene: ENSMUSG00000069170   Transcript: ENSMUST00000126444
Sequence length 1218
Comment pep:known chromosome:GRCm38:13:81560572:81633139:-1 gene:ENSMUSG00000069170 transcript:ENSMUST00000126444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTSEPGMISSFLLVYLSTLFISFVFGEAEIRFTGQTEFFVNETSTTVIRLVIERIGEP
ANVTAIVSLSGEDTGDFFDTYAAAFIPARGTNRTVYIAVCDDDLPEPDETFTFHLTLQKP
SANVKLGWPRAASVTILSNDNAFGIISFSTPSSISVIEPRSRNASVPLTLIREKGTYGMV
TVTFDVSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDDEVPENDELFLIQLRSVEG
GAEINASRSSVEIIVKKNDSPVNFMQSVYVVPEDDHVLTIPVLRGKDSDGNLIGSDETQV
SIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESHLKFQIIDDLIPEIAESFHIM
LLKNTLQGDAVLMGPSTVQVTIKPNDKPYGVLSFNSILFERPVIIDEDTASSSRFEEIAV
VRNGGTHGNVSVSWVLTRNSSDPSPVTADITPASGTLQFAQGQMLAPISLVVFDDDLPEE
AEAYLLTILPHTIQGGAEVSEPAQLLFYIQDSDNVYGEIAFFPGESQKIESSPSERSLSL
SLARRGGSKGDVRVIYSALYIPAGAMDPLRAKDGILNTSRRSSLLFPEQNQQVSIKLPIR
NDAFLQNGAHFLVQLEAVVLVNIFPPIPPVSPRFGEIRNISLLVTPAIANGEIGFLSNLP
IILHEPKDSSAEVVSIPLHRDGTDGQATVYWSLRPSGFNSKAVTLDDAGPFNGSVVFLSG
QNETSINITVKGDDIPELNETVTLSLDRVSVDSDVLKSGYTSRDLIILENDDPGGIFEFS
YDSRGPYVIKEGDAVELRITRSRGSLVKQFLRFHVEPRESNEFYGNMGVLEFTPGEREVV
ITLLTRLDGTPELDEHFWVILSSHGERESKLGCATLVNITILKNDYPHGIIEFVSDGLSA
SIKESKGEDIYHAVYGVIRTRGNFGAVNVSWMVSPDFTQDVFPVQGTVCFGDQEFFKNIT
VYSLVDEIPEEMEEFTIILLNATGGAQTGIRTTASLRILRNDDPVYFAEPCVLRVQEGET
ANFTVLRNGSVDGACTVQYATVDGKASGEEGDFAPVEKGETLVFEVGSREQSISVHVKDD
GIPETDEPFYIVLFNSTGDTVVYEYGVATVIIEANDDPNGVFSLEPIDKAVEEGKTNAFW
ILRHRGHFGNVSVAWQLFQNASLQPGQEFYETSGTVNFTDGEETKPVILRAFPDRIPEFN
EFYILRLVNISGTNLSHL
Download sequence
Identical sequences D3YYF1
ENSMUSP00000123552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]