SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000123612 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000123612
Domain Number - Region: 11-75
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0235
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000123612   Gene: ENSMUSG00000024018   Transcript: ENSMUST00000128751
Sequence length 97
Comment pep:known chromosome:GRCm38:17:29703332:29717012:-1 gene:ENSMUSG00000024018 transcript:ENSMUST00000128751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLEKEKHTLMNKA
SKYEKELKLLRHENRKNTLLSVAIFTVFALLYAYWTM
Download sequence
Identical sequences Q9D162
ENSMUSP00000123612 NP_081058.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]