SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124448 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124448
Domain Number 1 Region: 6-196
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-55
Family ALDH-like 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124448   Gene: ENSMUSG00000037542   Transcript: ENSMUST00000159163
Sequence length 215
Comment pep:putative chromosome:GRCm38:10:21377347:21388996:1 gene:ENSMUSG00000037542 transcript:ENSMUST00000159163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKRELLMLENFIGGKFLPCNSYIDSYDPSTGEVYCKVPNSGKEEIEAAVEAAREAFPAWS
SRSPQERSLVLNRLADVLEQSLEELAQAESKDQGKTLTLARTMDIPRSVLNFRFFASSNL
HHVSECTQMSHLGCMHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPSEM
TSVTAWMFCKLLDKADAVTQAHPTPTYQLLDSRRR
Download sequence
Identical sequences ENSMUSP00000124448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]