SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124567 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124567
Domain Number 1 Region: 34-72
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.00000185
Family 4HBT-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124567   Gene: ENSMUSG00000034853   Transcript: ENSMUST00000140541
Sequence length 76
Comment pep:known chromosome:GRCm38:4:106747391:106771556:-1 gene:ENSMUSG00000034853 transcript:ENSMUST00000140541 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
GFASMFSNRTSRKSISHPESGDPPTMAEGEGYRNPTEVQMSQLVLPCHTNHRGELSIGQL
LKWIDTTACLSVSAKW
Download sequence
Identical sequences F6SS52
ENSMUSP00000124567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]