SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125056 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125056
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily E set domains 8.86e-30
Family Arrestin/Vps26-like 0.00000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125056   Gene: ENSMUSG00000018909   Transcript: ENSMUST00000162290
Sequence length 121
Comment pep:putative chromosome:GRCm38:7:99594623:99600081:1 gene:ENSMUSG00000018909 transcript:ENSMUST00000162290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIV
SYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVPESETPVDTNLIELDTNNLLAC
M
Download sequence
Identical sequences F7DF62
ENSMUSP00000125056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]