SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125092 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125092
Domain Number 1 Region: 819-1010,1088-1170,1214-1276,1325-1382
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.79e-38
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 
Domain Number 2 Region: 273-490
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000659
Family Extended AAA-ATPase domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125092   Gene: ENSMUSG00000048148   Transcript: ENSMUST00000163026
Sequence length 1399
Comment pep:putative chromosome:GRCm38:8:72657086:72708033:1 gene:ENSMUSG00000048148 transcript:ENSMUST00000163026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNTQATDYLTTELCLEELERCQKTSIGPAFVALLGDQYGPCPVPRRIEEKEWEALRAQLT
SRPRDLELVTRHFQRDDNTIPPTYVLQPSGSLVVPGPEEATLTSVLRGGAQEAWRLGLIS
QEQWMCYHRSVIEWEIELGLLSSARGDQGATVFLRDVQDLNKHILDDCSLKMVDRLVDGC
LDTNAQSLLSGLKGRILDAQPGALKSHHLSWSRDLVNPKNKAHARYLKQLSEQFVARTNH
QVLEQLRELELARQELGWLYQEIRHHLWQSTESTKVFCGHQELLAQLRQQLRQDESRTHT
PLVLFGPPGIGKTSLMCKLAQQVPELLGHKTVVVLRLLGTSKLSLDARSLLRSLSFQVCL
AYGLPLPPAQVLEAHSRVGHFFHTLLHTVSQRNFESLVLLLDSVDDLDSICHSPRVSWLP
LKCPPRVHLILSTCSGQQVLHNLQQTLKDPSTYWEVKALSGSQGQEFIQLLLAAEKRMLS
PGQRDVLWASLPECGHPGRLRLAFEEARKWASFTVPVPLATTAEEATHQLCIRLEETHGA
LLVAHVLGYIVSSRYGLSEAELKDVLSLDDEVLQAVYRDWTPPSKELLRFPPLLWVRLRR
DLGHCLVRRPVDGCMLLAIAHRQLSQVIQVRYLSGPERAKRHGVLAEFFSGAWSQGIKKL
ITLPLVGKPLNLDRKVAPQPLWFSSTVANLRKLTELPFHLLHAGRLEELKQEVLGNMSWI
SCRGISGGIEVLLDDFDMCAPHMNSPEVDLVREAIQLCGPAVELRGLEKSVLYTELLARL
LFFAASHPAMIGQLCQQAQSWFRACPYPMLVPLAGFLQPPGGPLRATLTGCHKGITAIAW
SLEEKLLVVGTQDGAMVVWDVEEQQVVHVLMGHTAEVKCVRVFAQGTLAISASKDHTLRL
WSLLSGQEKVTILDGGSQNPTEPQSWDLHVDERNNVVYSTSGARINMWNLETSKLVFCIT
GDVSDPWVCVALLAAQGLLLALSKGGQVSLWSSAMGKLQEKHQLSSIKEETPTCAVSIQS
RARLVAGFSSGSIALVSAGEDRLLEKLPEAVGFLVVSEDDSLLVAGFGRFVRIFLADSQG
FHRFMASDLEHEDMVETAVLGPENNLIITGSRDALIQVWSLSEQGTLLNVLEGVGAPVSL
LVRGGTLVVSASRKSSSFKVWDLKSTKKLQSPTPFLDRTGLAAVSHHGSFVYFPKVGDKN
KVTIWDLAEGEEQDCLDTSNEVRCLEVAEQAKLLFTGLVSGIVLVFPLNSRQDVLCIPPP
EARKAVNCMSLSKSENRLAIAYDNIVLVLDISPGDPCPAIEGPTYTFYTQLPETIVSVAV
LADYRVVYGMSDGSLFLYDCACSKVFPLEAHGSRVSCVEVSHSEQLAVSGAEDALLCLWD
LQACRGMFEMSYEVGGLDN
Download sequence
Identical sequences ENSMUSP00000125092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]