SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125123 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125123
Domain Number 1 Region: 30-106
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 5.92e-20
Family 4HBT-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125123   Gene: ENSMUSG00000034853   Transcript: ENSMUST00000145061
Sequence length 107
Comment pep:putative chromosome:GRCm38:4:106763406:106799790:-1 gene:ENSMUSG00000034853 transcript:ENSMUST00000145061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSNRTSRKSISHPESGDPPTMAEGEGYRNPTEVQMSQLVLPCHTNHRGELSIGQLLKWI
DTTACLSAERHAGCPCVTASMDDIYFDHTISVGQVVNIKAKVNRAFN
Download sequence
Identical sequences E0CXP8
ENSMUSP00000125123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]