SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125180 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125180
Domain Number 1 Region: 19-115
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.68e-34
Family Eukaryotic proteases 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000125180
Domain Number - Region: 100-147
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.0764
Family MaoC-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125180   Gene: ENSMUSG00000033200   Transcript: ENSMUST00000162021
Sequence length 165
Comment pep:novel chromosome:GRCm38:17:25370553:25374440:1 gene:ENSMUSG00000033200 transcript:ENSMUST00000162021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGPYCGILLFLAVSEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARGP
GDACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEAGG
SGMQGLPWAPLLAALFWPSLFLLLVSGVLMAKYWLSSPSHAASEL
Download sequence
Identical sequences E9Q7E3
XP_006524427.1.92730 ENSMUSP00000125180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]