SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125478 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125478
Domain Number 1 Region: 618-1034
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.51e-93
Family alpha-mannosidase, C-terminal domain 0.042
Further Details:      
 
Domain Number 2 Region: 247-514
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.34e-84
Family alpha-mannosidase 0.0049
Further Details:      
 
Domain Number 3 Region: 515-616
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 9.81e-25
Family alpha-mannosidase, domain 2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125478   Gene: ENSMUSG00000032295   Transcript: ENSMUST00000160147
Sequence length 1039
Comment pep:known chromosome:GRCm38:9:57130690:57142722:1 gene:ENSMUSG00000032295 transcript:ENSMUST00000160147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPFLKHWRTTFERVEKFVSPIYFTDCNLRGRLFGDSCSVTLSSFLTPERLPYEKAVQ
QNFSPAQVGDSFGPTWWTCWFRVELVIPEVWVGQEVHLCWESDGESLVWRDGEPVQGLTK
EGEKTSYVLSERLRASDPRSLTLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSQAKLAVF
HRDVHSLLVDLELLLGVAKGLGEDSQRSFQALHTANQMVNICDPAQPETYPAAKALASKF
FGQHGGESQHTIHAMGHCHIDTAWLWPFKETVRKCARSWSTAVTLMEQNTDFIFACSQAQ
QLEWVKSQYPGLHARLQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEF
GKMCSEFWLPDTFGYSAQLPQIMQGCGIKRFLTQKLSWNLVNSFPHHTFFWEGLDGSRVL
VHFPPGDSYGMQGSVEEVLKTVTNNRDKGRTNHSGFLFGFGDGGGGPTQTMLDRLKRLSN
TDGLPRVQLSSPGQLFTALERDSGQLCTWVGELFLELHNGTYTTHAQLKKGNRECEQILH
DVEVLSSLALARSAQFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQLVAEDAMNYYEDIRS
HGNPLLSAAAAALCAGEPGPKGLLIINTLPWKRTEVLALPKPCGAHSLALVTVPSIGYAP
APTPTSLQPLLPQQPVFVMQETDGSVTLDNGIIRVRLDPTGCLTSLVLVASGREAIAEGA
LGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSAWFLLQISPNS
RLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARIRSPQATYEIQFGHLQRPTHNNT
SWDWARYEVWAHRWIDLSECDFGLALLNNCKYGASVRGNVLSLSLLRAPKAPDATADMGR
HEFTYALMPHKGSFQEAGVIHAAYNLNFPLLALPAPGPAPDTTWSAFSVSSPAVVLETIK
QAERCHQHRTLVLRLYEAHGSHVDCWLHTSLPVQEATLCDLLEQRDPTGHLSLQDNRLKL
TFSPFQVRSLLLVLQSPPN
Download sequence
Identical sequences Q91W89
10090.ENSMUSP00000034836 ENSMUSP00000125478 NP_082912.1.92730 ENSMUSP00000034836 ENSMUSP00000125478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]