SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125664 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000125664
Domain Number - Region: 99-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0173
Family Voltage-gated potassium channels 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125664   Gene: ENSMUSG00000024112   Transcript: ENSMUST00000159623
Sequence length 147
Comment pep:known chromosome:GRCm38:17:25397625:25433278:-1 gene:ENSMUSG00000024112 transcript:ENSMUST00000159623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGTLAADEVRVPLGASPSAPAAPVRASPASPGVPGREEQRGSGSSVLAPESPGTECGA
DLGADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHISMLVIMLNCVTLGMF
RPCEDVECRSERCSILEAFDDFIFAFF
Download sequence
Identical sequences E9Q6E4
ENSMUSP00000125664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]