SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125779 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000125779
Domain Number - Region: 15-71
Classification Level Classification E-value
Superfamily HCP-like 0.034
Family HCP-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125779   Gene: ENSMUSG00000039474   Transcript: ENSMUST00000167937
Sequence length 157
Comment pep:known chromosome:GRCm38:5:36968501:36976956:-1 gene:ENSMUSG00000039474 transcript:ENSMUST00000167937 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XADVEIPFEEVLEKAKAGDPKAQTEVGKHYLRLANDADEELNSCSAVAWLILAAKQGRRE
AVKLLRRCLADRKGITSENEAEVKQLSSETDLERAVRKAALVMYWKLNPKKKKQVAVSEL
LENVGQVNEQDGGAQPGPVPKSLQKQRRMLERLVSSE
Download sequence
Identical sequences F7D926
ENSMUSP00000125779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]