SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125809 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125809
Domain Number 1 Region: 2003-2172
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-31
Family C-type lectin domain 0.00067
Further Details:      
 
Domain Number 2 Region: 1740-1852
Classification Level Classification E-value
Superfamily CalX-like 2.22e-20
Family CalX-beta domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000125809
Domain Number - Region: 394-434
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.00615
Family Purple acid phosphatase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125809   Gene: ENSMUSG00000059049   Transcript: ENSMUST00000170248
Sequence length 2173
Comment pep:known chromosome:GRCm38:4:82897920:83052167:-1 gene:ENSMUSG00000059049 transcript:ENSMUST00000170248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSPGCTGPKAQWFLLLQLLLLHLDRVSATFISINRGLRVMKGSSAFLSGDHLRVAVPKE
KDACRLEVVMNEPVTQRVGKLSPQVFDCHFLPNEVKYVHNGCPILDEDSVKLRLYRFTET
DTFMETFLLRVYLVEPDCNIIRMSSNVLEVTEFYGLSQAIDKNLLQFDYDRTASLDCTIR
LDPLRTQLPAHGKLVVVNRKSEGPRGDQPHSFFSETELGAGLKCPDGSCALELKQVASLK
VSCEEFLLTGFHYQHMQPPSPNIDYIPIQLDLTDRRSKTVYKKSESAWLPVYIRVGIPNQ
VPRAAFMAMFVLEVDQFILTPLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTR
PISSFTWKDLSDMQVAYQPPNSSHPERRHYTMELEVYDFFFERSAPITVHISIRTADTNA
PRVSWNTGLNLLEGQSRAITWEQFQIVDNDDIGAVQLVTIGGLQHGRLTVREGKGFLFTV
TDLQAGVVRYHHDDSDTTKDFVAFRIFDGHHSSHHKFPINILPKDDSPPFLITNVVIELE
EGKTILIQGSMLRASDMDSSDDYIFFNITKFPQAGEIMKKPGPRLIGYPVPGFLQRDLFS
GIIYYRHFGGEIFEDSFEFVLWDSHEPPNLSVPQVVTIHITPVDDQLPKEAPGISRHLVV
KETEVAYITKKHLHFLDMESRDGELIYTVTRPPCFSFSHRHLDAGKLFMVDSIPKLTKNP
TAPGLSSFTQHAVNHMKVAYMPPMQDIGPSPRHVQFTVSVSNQHGGALHGICFNITVLPV
DNQVPEVFTNTLRVVEGGQCTISTEHILVSDVDTPLDSISLSLKERPLHGGVELDGFPLN
PRGTFSWRDLNTLKVWYQHDGSEVLQDEIFLEVTDGTNSAAFVLHIEVFPVNDEPPILKA
DLIPMMHCSEGGEVTITPEYISATDADSDDLELLFLIAREPQHGVVRKAGLHVDRFSQGD
VISGAVTYKHTGGEIGLEPCSDTVVLVVSDGEADPLMNGCCYDGPDSSVPLHKSFPTYQL
NITVHPVDNQPPSIIIGRMLTVDEGFSAALTTHHLTVVDWDTAPDDLKFMLASQPQFGYL
ENALPSAGFEKSNIGIRIASFQWTDMKASHINYVQSRHLRVEPTADQFTVYATDGKHRSL
ETTFHVIINPTNDEAPDLAVQNITVYEGHMVELDSSIISATDRDIPKDPLLFSIALKPQH
GLLVDAAISKDSHQIKQLQHEIHSFSVDLLKNGMKLVYAHDDSESSADNFVIQLSDGKHK
ILKTISVNITPVNDETPTLSKKAEISMAVGDTRVLSSAVLSATDKDSPREKIHYVFERLP
QNGQLQLKIGRDWVPLSTGMQCTQEDVDLNLLRYTHAGKTDSQDGDSFTFYLWDEDNRSP
AFDCHIIIEDMGKGDIVIHAKPLVVVKGDRGLLTTATLLAVDGADKPEELLYLITSPPRH
GQVEYVHSPGVPIASFSQMDIAGQTVCYIHKSRTAVPTDSFRFTISNGLQTQRGVFEITL
QTVDSALPVLTKNKRLRLAEGAMGLLSADHLQLTDPDTPPENLTFFLAQLPRHGYLFLRG
KALQHNFTQRDVDSGGVAYQHSGGGAREDYFTFLATDRKNQGFVVDGKVQKEPVRFTIQV
DQLDKAAPRITHLHSPTQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILRGPLYGR
LENTTTGEFIHERFSQKDLSHKTILYIINPSLQVTSDILEFQAMDPTGNTATPQSLDLRW
SYIEWAQTAYEVCENVGLLPLEVTRRGYPMDSAFVGVEVNQVSATVGKDFTVTPSKLLQF
DPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTQTKAAVKILDSKGGRCHPSNS
FNQSKHSTWGKGPWHPLPSGSSSLTTSGSPLLERPPPSFTSGDALQGFGLTDLTQRKTMT
QGNGKSVLPSSVCRNGTDTIYNYHGIVSLKLEGDRFSAHKRKAKISIVSQPQRTIKVAEL
PLADKVESTTDLHFLRQGLRPLFPKNCSVDLKGLFHFEESTHRLYQCDGISWKAWSPQTK
GLEDRSCPGGWLLHSGYCHILVTRQKGTWTTATRACREQHQGDLVTVLSRRHMQWLWAMS
GRKPFWIGLKNQPRTGHWEWIGGEPVAFTNWRRGAPLHPKPGKNCALVQKRGQWQTKNCS
KGKAHNFVCSRKL
Download sequence
Identical sequences E9Q5Z7
ENSMUSP00000125809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]