SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126153 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126153
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.5e-42
Family Nip7p homolog, N-terminal domain 0.00000207
Further Details:      
 
Domain Number 2 Region: 92-123
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000845
Family PUA domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126153   Gene: ENSMUSG00000031917   Transcript: ENSMUST00000170962
Sequence length 133
Comment pep:known chromosome:GRCm38:8:107056877:107060926:1 gene:ENSMUSG00000031917 transcript:ENSMUST00000170962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEMMLKLAANISG
DKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKGFGVAAKSTQDCRKVDPMAIVVFHQA
DIGEYVRHEETLT
Download sequence
Identical sequences E9Q109
NP_001157944.1.92730 ENSMUSP00000126153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]