SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126235 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126235
Domain Number 1 Region: 168-273
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-32
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 2 Region: 67-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 107-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000583
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126235   Gene: ENSMUSG00000025075   Transcript: ENSMUST00000171341
Sequence length 274
Comment pep:known chromosome:GRCm38:19:56287996:56316295:1 gene:ENSMUSG00000025075 transcript:ENSMUST00000171341 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLVFRVLLLIALVGKSVIGLSLMSFIAPPDPDWTPDDYYYSYEQSSPDEDPSVTQTTPEN
PDWYYEDDDPCQSNPCEHGGDCIIRGDTFSCSCPAPFSGSRCQTAQNKCKDNPCVHGDCL
ITQKHPYYRCACKYPYTGPDCSKVLPACRPNPCQNGGVCSRHRRRSRFTCACPDQYKGKF
CEIGPDDCYVGDGYSYRGKVSKTVNQNPCLYWNSHLLLQETYNMFMEDAETHGIAEHNFC
RNPDGDHKPWCFVKVNSEKVKWEYCDVTVCPVPA
Download sequence
Identical sequences E9Q0C5
ENSMUSP00000126235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]