SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126254 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000126254
Domain Number - Region: 342-397
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0445
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126254   Gene: ENSMUSG00000027860   Transcript: ENSMUST00000168312
Sequence length 476
Comment pep:known chromosome:GRCm38:3:102158183:102203963:-1 gene:ENSMUSG00000027860 transcript:ENSMUST00000168312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQAPAGEPLLAND
SARTGAEEVQDDNWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASF
LGLLVFLTPIAFILLPQILWREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRAD
VPRVFVFRALLLVLIFLFVVSYWLFYGVRILDSRDQNYKDIVQYAVSLVDALLFIHYLAI
VLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYNPNLLTAS
KFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRALQKY
LRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLISE
EAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV
Download sequence
Identical sequences Q3UXU7
ENSMUSP00000126254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]