SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126586 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126586
Domain Number 1 Region: 32-175
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.66e-55
Family Glyoxalase I (lactoylglutathione lyase) 0.00000693
Further Details:      
 
Domain Number 2 Region: 40-174
Classification Level Classification E-value
Superfamily PDB 0.0000000000167
Family PDB 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126586   Gene: ENSMUSG00000024026   Transcript: ENSMUST00000167624
Sequence length 184
Comment pep:known chromosome:GRCm38:17:30592866:30612659:-1 gene:ENSMUSG00000024026 transcript:ENSMUST00000167624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQK
LDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKI
ATII
Download sequence
Identical sequences A5GZX3 Q9CPU0
400255 10090.ENSMUSP00000024823 NP_001107032.1.92730 NP_079650.3.92730 cath|current|2za0A00/4-183 cath|current|2za0B00/9-184 cath|current|4kyhA00/6-182 cath|current|4kyhB00/9-184 cath|current|4kykA00/6-184 cath|current|4kykB00/8-184 ENSMUSP00000024823 2za0_A 2za0_B 4kyh_A 4kyh_B 4kyk_A 4kyk_B 4opn_A 4opn_B 4x2a_A 4x2a_B ENSMUSP00000024823 ENSMUSP00000024823 ENSMUSP00000126586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]