SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126645 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000126645
Domain Number - Region: 36-99
Classification Level Classification E-value
Superfamily DNA clamp 0.00523
Family DNA polymerase processivity factor 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126645   Gene: ENSMUSG00000022248   Transcript: ENSMUST00000169519
Sequence length 133
Comment pep:known chromosome:GRCm38:15:10486080:10490347:1 gene:ENSMUSG00000022248 transcript:ENSMUST00000169519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQYNEEEYEQYCLVASLDNVRNLSTVLKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQADVFQEFVIQEESVTFRINLTILLDCLSIFGSSPTPGTLTALRMCYQGYGHPLM
LFLEEGGVVTVCK
Download sequence
Identical sequences E9PXK0
ENSMUSP00000126645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]