SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126692 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126692
Domain Number 1 Region: 43-131
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000331
Family FHA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126692   Gene: ENSMUSG00000046688   Transcript: ENSMUST00000164447
Sequence length 184
Comment pep:known chromosome:GRCm38:3:127790657:127797949:1 gene:ENSMUSG00000046688 transcript:ENSMUST00000164447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFEDADTEETVTCLQMTIYHPGQQSGIFKSIRFCSKEKFPSIEVVKFGRNSNMCQYTF
QDKQVSRIQFVLQPFKQFNSSVLSFEIKNMSKKTSLMVDNQELGYLNKMDLPYKCMLRFG
EYQFLLQKEDGESVESFETQFIMSSRPLLQENNWPTQNPIPEDGMYSSYFTHRSSPSEMD
ENEL
Download sequence
Identical sequences I3PQW8 Q793I8
ENSMUSP00000054036 10090.ENSMUSP00000054036 NP_660115.1.92730 XP_006501299.1.92730 XP_006501300.1.92730 XP_006501301.1.92730 XP_006501302.1.92730 ENSMUSP00000054036 ENSMUSP00000126692 ENSMUSP00000127700 ENSMUSP00000132309 GO.35673 ENSMUSP00000054036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]