SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126736 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126736
Domain Number 1 Region: 48-261,511-584
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.06e-32
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number 2 Region: 513-772
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.91e-28
Family WD40-repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126736   Gene: ENSMUSG00000046991   Transcript: ENSMUST00000170386
Sequence length 780
Comment pep:known chromosome:GRCm38:17:14829331:14934653:-1 gene:ENSMUSG00000046991 transcript:ENSMUST00000170386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPEMPSTDGHTRAIVTERYVVESKKSAAHVPLACSTQHCAFPLDGSRLCVWSSKDPS
HQLLTLQGHHQLITAVVFGNQIDPLLLCSASEDYIIMWNVAECREKTLKGLTPRGTILGS
LLQTVLCLRFSLDDRAIAVCAGNKISVMDVEKQSVLVELKGHQGSVTAVEFCPWQAHTLI
SVSEDRSFKVWDFCVGSLIYSSSILTAYPLLNLLINEENQQLVTGSADGQLWIFSLMEGH
HYHCVAHVDVRKKRETFTTRRMMAEQCSLPEDHQCRCRHEADKRGEAEATFPILSLAPCD
LCLPDSQRGAFASECTKCLWIGSSTALFILNLASFELEAALHFKEFQSLSVQVAGSCAMV
SEPMSAKAFCMLSSMFGSKIAVLEIDLAALLSTQQYPRAGKVLSVLASSCVLPTSPLYFG
IIKEKFPKLANTKQHAVKSVVEDRPLVFHTKVRSSGYTLAPHMAMFSPKTNIKHHNKRSS
KYKNNYKCKECSLENFLPRNLSRQVAVAQKPVAVSCLQFSGDGQKLACGLGNHLSLVFNA
SLSGPPAAFSGHDGAVSTICWSHDKRWLLSTGRDRTLRVWSVHRTELMLLLAPDAFPKPV
TSAQFYYMDTFILLSSGPEFCLLKYHIDLCRDDIRRYKPKSRYKPIFRLPMTSGADITSL
SAVNDFYSHIVLTAGRDRAVEVFDLNAGCSAAVLAEVHSRPVHRICQNKGSSFVAQHSLA
YNLFLTAAVGDGIRLWDLRNLRLMCMKWAPAAFCTVLQDTQIRLLKWPSTQQLLSLSQPP
Download sequence
Identical sequences Q8C5V5
ENSMUSP00000126736 10090.ENSMUSP00000061342 ENSMUSP00000126736 MmR107 NP_780382.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]