SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000126761 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000126761
Domain Number 1 Region: 154-254,422-493
Classification Level Classification E-value
Superfamily TrmE connector domain 1.31e-41
Family TrmE connector domain 0.0037
Further Details:      
 
Domain Number 2 Region: 105-185,222-412
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.36e-34
Family G proteins 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000126761   Gene: ENSMUSG00000007610   Transcript: ENSMUST00000168847
Sequence length 493
Comment pep:known chromosome:GRCm38:8:71488103:71493400:1 gene:ENSMUSG00000007610 transcript:ENSMUST00000168847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLSALVTQAAWAPLRLCARCSTSAESLVPSSTIFALSSGQGRCAIAVIRTSGPASGL
ALRSLTALQEPPPARRACLRLLRHPCSGEPLDRSLVLWFPEGPQSFTGEDCVEFHVHGGP
AVVSGVLQALGSVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLADLIRAETEAQRRQALRQ
LDGELSQLCQGWAKTLTKALAYVEAYIDFGEDDNLEEGVLEQADREVRALEVALGSHLRD
ARRGQRLLSGANVVVTGPPNAGKSSLVNLLSQKPVSIVSPEPGTTRDVLETPVDLAGFPV
LLSDTAGLREGVGAVEQEGVRRARHRLEQADIILGVLDASDLASSSSCSFLDTVVTPLLA
QSQDSGGQRLLLLLNKSDLLSANAPACDIALPPHLLLSCHTGAGMDSLLQALKTELAAVC
GDPSTGPPLLTRVRHQYHLQGCLDALGHYQLATDLALAAEALRQARRQLNHLTGGGGTEE
ILDLIFQDFCVGK
Download sequence
Identical sequences E9PWV7
ENSMUSP00000126761 ENSMUSP00000126761 ENSMUSP00000123082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]