SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127105 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000127105
Domain Number - Region: 17-39
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0238
Family Glutamine synthetase, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127105   Gene: ENSMUSG00000038371   Transcript: ENSMUST00000167652
Sequence length 44
Comment pep:known chromosome:GRCm38:7:110462876:110614761:-1 gene:ENSMUSG00000038371 transcript:ENSMUST00000167652 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MARLADYFIVVGYDHEKPVLSTWWMAPVQRAETANILCGGPNRY
Download sequence
Identical sequences E9Q4I8
ENSMUSP00000127105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]