SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127114 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127114
Domain Number 1 Region: 332-685
Classification Level Classification E-value
Superfamily Urocanase 1.15e-128
Family Urocanase 0.00000183
Further Details:      
 
Domain Number 2 Region: 85-302
Classification Level Classification E-value
Superfamily Urocanase 8.24e-90
Family Urocanase 0.00000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127114   Gene: ENSMUSG00000034456   Transcript: ENSMUST00000164761
Sequence length 710
Comment pep:novel chromosome:GRCm38:6:90333289:90364546:1 gene:ENSMUSG00000034456 transcript:ENSMUST00000164761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLQELCSGLPLRPLPENRGRWAGVPHAPVRTPNLSPEEEQLALRNALRYFPPDVQKLL
ALEFAQELRQFGHIYMYRFCPSIEMRAYPIDQYPCRTRAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQFRLTMSYLSKMTEEQTLVMYSGHPLGLFPSSPRAPRLVITNGM
VIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAGRRYLGIENLA
GKVFVTSGLGGMSGAQAKAAAIVGCIGVIAEVDKAALVKRHRQGWLMEVTDSLDRCIARL
RYGLAVWDPEHLTLSTGSRGESMTWAIQCLMFDHREARKKKEVLSLGYHGNVVDLWERLV
HELDTTGELLVDLGSDQTSCHNPFNGGYYPVQLSFSEAQSLMSSNPAAFKHLVQESLRRH
VAAINRLAQEKFFFWDYGNAFLLEAQRAGADVEKKGANKMEFRYPSYVQHIMGDIFSQGF
GPFRWVCTSGDPQDLAVTDHLATSVLEKAIADGVKASVKLQYMDNIRWIREAAKHQLVVG
SQARILYSDQKGRVAIAVAINQAIASGKIKAPVVLSRDHHDVSGTDSPFRETSNIYDGSA
FCADMAVQNFVGDACRGATWVALHNGGGVGWGEVINGGFGLVLDGTAEAEQKARMMLSWD
VSNGVARRCWSGNPKAYEIICQTMQENSGLVVTLPHEVADEQVLQQALRP
Download sequence
Identical sequences Q3UEL5
XP_006506154.1.92730 ENSMUSP00000127114 ENSMUSP00000127114 ENSMUSP00000127114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]