SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127206 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127206
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.74e-27
Family G proteins 0.0000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127206   Gene: ENSMUSG00000028057   Transcript: ENSMUST00000171645
Sequence length 109
Comment pep:known chromosome:GRCm38:3:88716876:88726369:1 gene:ENSMUSG00000028057 transcript:ENSMUST00000171645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGARPIGSSCSSPAALSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKI
RIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFH
Download sequence
Identical sequences E9Q3Z0
ENSMUSP00000127206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]