SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127625 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127625
Domain Number 1 Region: 52-147
Classification Level Classification E-value
Superfamily ALDH-like 1.1e-18
Family ALDH-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127625   Gene: ENSMUSG00000053644   Transcript: ENSMUST00000170309
Sequence length 161
Comment pep:putative chromosome:GRCm38:18:56537248:56562226:-1 gene:ENSMUSG00000053644 transcript:ENSMUST00000170309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XMWRVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSW
GGRGEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGD
AFREKIQLLGRLVSLEMGKILVEGIGEDADLSLVVPSVLFA
Download sequence
Identical sequences E9Q1H3
ENSMUSP00000127625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]