SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127708 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127708
Domain Number 1 Region: 203-276
Classification Level Classification E-value
Superfamily ApaG-like 1.26e-20
Family ApaG-like 0.0019
Further Details:      
 
Domain Number 2 Region: 42-109,136-166
Classification Level Classification E-value
Superfamily YccV-like 0.00000000000902
Family YccV-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127708   Gene: ENSMUSG00000001100   Transcript: ENSMUST00000133601
Sequence length 284
Comment pep:known chromosome:GRCm38:11:78512416:78522171:1 gene:ENSMUSG00000001100 transcript:ENSMUST00000133601 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XAGGLPPVATATTRRHLSSRNRAEGKVLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVV
LFPWQARLYDRDVASATPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEA
VTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVAR
ETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDS
DVVQLRERHWRIFSLSGTLETVRGRGVVGRVSILGPLWPRCWSC
Download sequence
Identical sequences F6SQH7
ENSMUSP00000127708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]