SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000127808 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000127808
Domain Number 1 Region: 337-677
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.24e-132
Family Transferrin 0.000000000568
Further Details:      
 
Domain Number 2 Region: 21-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.5e-110
Family Transferrin 0.000000000662
Further Details:      
 
Domain Number 3 Region: 772-976
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.53e-30
Family G proteins 0.00000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000127808   Gene: ENSMUSG00000090639   Transcript: ENSMUST00000166836
Sequence length 978
Comment pep:putative chromosome:GRCm38:9:103190208:103230307:-1 gene:ENSMUSG00000090639 transcript:ENSMUST00000166836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPPDGPRLACVK
KTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVEHPQTYYYAVAVV
KKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRSPLEKDPVAFPKLCQLCP
GCGCSSTQPFFGYVGAFKCLKDGGGDVAFVKHTTIFEVLPEKADRDQYELLCLDNTRKPV
DQYEDCYLARIPSHAVVARKNNGKEDLIWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLF
KDSAFGLLRVPPRMDYRLYLGHNYVTAIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCD
EWSIISEGKIECESAETTEDCIEKIVNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSN
CAIPSQQGIFPKGYYAVAVVKASDTSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRIN
HCKFDEFFSQGCAPGYEKNSTLCDLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVK
HQTVLDNTEGKNPAEWAKNLKQEDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKA
ARVKAVLTSQETLFGGSDCTGNFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYM
QSVGNMRKCSTSPEIPLRDYNSRDAPRPTTAWSLEPRNFGGPGRLHTSFMASANTRRVGD
GAGGAFQPYLDSLRQELQQRDPTLLSVAVALLAVLLTLVFWKFIWSRKSSQRAVLFVGLC
DSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHESLRFQLLDRFK
SSARAVVFVVDSAAFQREVKDVAEFLYQVLIDSMALKNSPSLLIACNKQDIAMAKSAKLI
QQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRG
DTGSADIQDLEKWLAKIA
Download sequence
Identical sequences E9Q035
ENSMUSP00000127808 ENSMUSP00000127808 ENSMUSP00000127808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]