SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128601 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000128601
Domain Number - Region: 8-70
Classification Level Classification E-value
Superfamily DNA clamp 0.0175
Family DNA polymerase processivity factor 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128601   Gene: ENSMUSG00000022248   Transcript: ENSMUST00000170100
Sequence length 163
Comment pep:known chromosome:GRCm38:15:10486609:10493674:1 gene:ENSMUSG00000022248 transcript:ENSMUST00000170100 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
LKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQADVFQEFVIQEESVTFRINLTILL
DCLSIFGSSPTPGTLTALRMCYQGYGHPLMLFLEEGGVVTVCKITTQEPEETLDFDFCST
NVMNKIILQSEGLREAFSELDMTGDVLQITVSPDKPYFRKLPS
Download sequence
Identical sequences F7CJR1
ENSMUSP00000128601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]