SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128609 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128609
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.86e-101
Family Transferrin 0.00000000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128609   Gene: ENSMUSG00000032554   Transcript: ENSMUST00000168142
Sequence length 249
Comment pep:novel chromosome:GRCm38:9:103210568:103219866:-1 gene:ENSMUSG00000032554 transcript:ENSMUST00000168142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGYYAVAVVKASDTSITWNNLKGKKSCH
TGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLCDLCIGPLKCAPNNKEE
YNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQEDFELLCPDGTRKPVKD
FASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTGNFCLFKSTTKDLLFRDDT
KCFVKLPEG
Download sequence
Identical sequences F7CJN9
ENSMUSP00000128609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]