SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128661 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128661
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.76e-71
Family Alanine racemase-like, N-terminal domain 0.000000000531
Further Details:      
 
Domain Number 2 Region: 266-418
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.26e-51
Family Eukaryotic ODC-like 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128661   Gene: ENSMUSG00000011179   Transcript: ENSMUST00000171737
Sequence length 461
Comment pep:known chromosome:GRCm38:12:17544873:17551502:1 gene:ENSMUSG00000011179 transcript:ENSMUST00000171737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFTKDEFDCHILDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQLVQGLGVPAERVIYANPCKQVSQI
KYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPG
SEDTKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQ
PGSDDEDESNEQTFMYYVNDGVYGSFNCILYDHAHVKALLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVMSRPMWQLMKQI
QSHGFPPEVEEQDDGTLPMSCAQESGMDRHPAACASARINV
Download sequence
Identical sequences P00860
10090.ENSMUSP00000011323 ENSMUSP00000128661 NP_038642.2.92730 XP_017170479.1.92730 ENSMUSP00000128661 ENSMUSP00000128661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]