SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128926 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128926
Domain Number 1 Region: 394-531
Classification Level Classification E-value
Superfamily CalX-like 7.72e-31
Family CalX-beta domain 0.00000838
Further Details:      
 
Domain Number 2 Region: 523-674
Classification Level Classification E-value
Superfamily CalX-like 2.88e-28
Family CalX-beta domain 0.00000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128926   Gene: ENSMUSG00000030376   Transcript: ENSMUST00000168693
Sequence length 921
Comment pep:known chromosome:GRCm38:7:16130300:16160509:1 gene:ENSMUSG00000030376 transcript:ENSMUST00000168693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLALMGVVLLLGVPHCLGEATPTPSLPPPTANDSDASPEGCQGSYRCQPGVLLPVWEP
EDPSLGDKVARAVVYFVAMVYMFLGVSIIADRFMASIEVITSKEKEITITKANGETSVGT
VRIWNETVSNLTLMALGSSAPEILLTVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAVC
VYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLIFFPVCV
VFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGTEVPGELGALGT
GPAEARELDASRREVIQILKDLKQKHPDKDLEQLMGIAKYYALLHQQKSRAFYRIQATRL
MTGAGNVLRRHAADAARRPGATDGAPDDEDDGASRIFFEPSLYHCLENCGSVLLSVACQG
GEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETQKDLRIGIIDDDIFEEDEHFFV
RLLNLRVGDAQGMFEPDGGGRPKGRLVAPLLATVTILDDDHAGIFSFQDRLLHVSECMGT
VDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDEE
YEKKDNFFIELGQPQWLKRGISALLLNQGNGDKKITAEQEEAQRIAEMGKPVLGENNRLE
VIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFIEAVTVSAGDEEEDEDGPREERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCNGWACFGVCILVIGVLTALIGDLASHFGCTVGLK
DSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAVY
WAVQGRPFEVRAGTLAFSVTLFTVFAFVCIAVLLYRRRPQIGGELGGPRGPKLATTALFL
GLWFLYILFSSLEAYCHIRGF
Download sequence
Identical sequences Q8K596
10090.ENSMUSP00000006175 NP_683748.1.92730 ENSMUSP00000128926 ENSMUSP00000128926 ENSMUSP00000128926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]