SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128964 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128964
Domain Number 1 Region: 60-220
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-41
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily Kringle-like 6.96e-17
Family Kringle modules 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128964   Gene: ENSMUSG00000025075   Transcript: ENSMUST00000163502
Sequence length 220
Comment pep:putative chromosome:GRCm38:19:56311814:56316417:1 gene:ENSMUSG00000025075 transcript:ENSMUST00000163502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HGIAEHNFCRNPDGDHKPWCFVKVNSEKVKWEYCDVTVCPVPDTPNPVESLLEPVMELPG
FESCGKTEVAEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGALIHPCWV
LTAAHCTDINTKHLKVVLGDQDLKKTESHEQTFRVEKILKYSQYNERDEIPHNDIALLKL
KPVGGHCALESRYVKTVCLPSDPFPSGTECHISGWGVTET
Download sequence
Identical sequences F7B276
ENSMUSP00000128964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]