SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129009 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129009
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000208
Family Extradiol dioxygenases 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129009   Gene: ENSMUSG00000017286   Transcript: ENSMUST00000170590
Sequence length 66
Comment pep:known chromosome:GRCm38:11:76234519:76243669:-1 gene:ENSMUSG00000017286 transcript:ENSMUST00000170590 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MATRRALHFVFKVKNRFQTVHFFRDVLGMQVLRHEEFEEGCKAACNGESRLLLAKLSAMP
GSWSGH
Download sequence
Identical sequences E9Q2R6
ENSMUSP00000129009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]