SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129013 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129013
Domain Number 1 Region: 22-135
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.18e-36
Family Transferrin 0.00000681
Further Details:      
 
Domain Number 2 Region: 135-171
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000236
Family Transferrin 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129013   Gene: ENSMUSG00000032554   Transcript: ENSMUST00000165296
Sequence length 171
Comment pep:novel chromosome:GRCm38:9:103222097:103230266:-1 gene:ENSMUSG00000032554 transcript:ENSMUST00000165296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHMKTVLPPDGPRLACVK
KTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFYGSVEHPQTYYYAVAVV
KKGTDFQLNQLEGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYL
Download sequence
Identical sequences E9Q2Q7
ENSMUSP00000129013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]