SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129116 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129116
Domain Number 1 Region: 322-499,534-700
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.72e-82
Family YicI catalytic domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 1196-1389,1427-1595
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.67e-72
Family YicI catalytic domain-like 0.00036
Further Details:      
 
Domain Number 3 Region: 78-321
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.69e-50
Family YicI N-terminal domain-like 0.0068
Further Details:      
 
Domain Number 4 Region: 948-1193
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.39e-45
Family YicI N-terminal domain-like 0.0079
Further Details:      
 
Domain Number 5 Region: 1598-1678
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.3e-17
Family Putative glucosidase YicI, domain 3 0.018
Further Details:      
 
Domain Number 6 Region: 703-783
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000018
Family Putative glucosidase YicI, domain 3 0.023
Further Details:      
 
Domain Number 7 Region: 921-971
Classification Level Classification E-value
Superfamily Trefoil 0.0000000162
Family Trefoil 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129116   Gene: ENSMUSG00000027790   Transcript: ENSMUST00000167334
Sequence length 1818
Comment pep:known chromosome:GRCm38:3:72888557:72967863:-1 gene:ENSMUSG00000027790 transcript:ENSMUST00000167334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKKFSGLEISLIVLFIIVTIIAIALVVVLATKVPAVEEVKSPTSTPSPGRCPPEQGEP
LNERINCIPEQHPTKAKCEERGCCWRPWNNTIIPWCFFADNHGYTAASVTNDNSGLKATL
SRIPSPTLFGEDIKSVLLTTQSQTRNRFRFKLTDPNNKRYEVPHQFVKDGNGIPAADTLY
DVKVSENPFSIKVIRKSNNKVLFDTSIGPLVYSNQYLQISTRLPSEYIYGFGEHIHKRFR
HDLYWKTWPIFTRDEIPGDNNHNLYGHQTFFMGIEDNSGKSYGVFLMNSNAMEVFIQPTP
IITYRVTGGVLDFYIFLGDTPEQVVQQYQELIGRPAMPAYWNLGFQLSRWNYVSLDKVKE
VVRRNREAGIPYDAQVTDIDYMEDKKDFTYDEVAFKGLPEFAQDLHNHGQKYIIILDPAI
SINKRANGAEYQTYVRGNEQNVWVKESDGTTSLIGEVWPGLTVYPDFTNPRTWEWWANEC
NLFHQQVEYDGLWIDMNEVSSFIHGSQKGCAPNLLNYPPFTPGILDKIMYSKTLCMDAVQ
HWGNQYDVHSLYGYSMAIATEKAVEKVFPNKRSFILTRSTFAGSGHHAAHWLGDNTASWE
QMEWSITGMLEFGMFGMPLVGADICGFLANTTEELCRRWMQLGAFYPFSRNHNAEGYAEQ
DPAFWGADSLLVNTSRHYLTIRYTLLPFLYTLFYRAHAFGETVARPFLHEFYEDPNSWIE
DTQFLWGPALLITPVLRPETKYVSAYIPDATWYDYETGEKRPWRKQRVDMYLPEDKIGLH
LRGGYIIPTQQPDVTTTASRKNPLGLIVALDENQAAKGELFWDDGESKDTIEKKIYILYE
FSVSNNNLIVNCTHSSYPEGNTLVFKTIKVLGLSATVTAVTVGENDQQMNPHLAFTFDAF
NKILSITDLTFNLGKTFIVRWTTQSFSDNEKFTCYPDVGTATEKTCVERGCIWEPVSGLA
NVPPCYFPSNHNPYLLTSTQKLATGITAELQLNPASARIKLPSNPISTLRVEVKYHKNDM
LQFKIYDAHHKRYEVPVPLNIPDTPTSSEENRLYDVEIKENPFGIQVRRRSTGKLIWDSC
LPGFAFNDQFIQISTRLPSQYLYGFGEAEHTAFKRNLNWHTWGMFTRDQPPGYKLNSYGF
HPYYMALEDEGNAHGVLLQNSNGMDVTFQPTPALTYRTIGGILDFYMFLGPTPEGATKQY
HEVIGFPVMPPYWALGFQLCRYGYRNTSEIEQLYNDMKAAQIPYDVQYTDINYMERQLDF
TIGERFKTLPQFVEKIRKEGMKYIVILDPAISGNETQPYPAFERGIQKDVFVKWPNTNDI
CWAKVWPDLPNITIDETITEDEAVNASRAHVAFPDFFRNSTSEWWTREIYDFYNEKMKFD
GLWIDMNEPSSFVNGTVTNKCRNDTLNYPPYFPELTKRNEGLHFRTMCMETEHILSDGSS
VLHYDVHNLYGWSQVKPTLDALRNTTGLRGIVISRSTYPTAGRWGGHWLGDNYANWENLE
KSLIGMLEFNLFGIPYVGADICGFFNDSEYHLCARWMQVGAFYPYSRNHNIQFTRRQDPV
SWNETFAQMSKKVLEIRYTLLPYFYTQMHEAHIHGGTVIRPLMHEFFDDKETWEIYKQFL
WGPAFMVTPVIGPFQTAVNGYVPKARWFDYHTGEDIKVRGKLQTFSAPFDTINLHVRGGY
ILPCQEPAQNTYYSRQKYMKLIVAADDNQTAKGTLFWDDGESIDTYEKNQYTLIEFNLNQ
KNLTSTVLKDGYRNKSEMKLGSIYVWGKGTTSISQVNLTYGGNEQQLSFTQDEAKEILTI
DLKNVTVTLDEPIQISWS
Download sequence
Identical sequences F8VQM5
10090.ENSMUSP00000091742 NP_001074606.1.92730 XP_006502107.1.92730 ENSMUSP00000091742 ENSMUSP00000129116 ENSMUSP00000091742 ENSMUSP00000091742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]