SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130108 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000130108
Domain Number - Region: 247-343
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00286
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130108   Gene: ENSMUSG00000058440   Transcript: ENSMUST00000167972
Sequence length 503
Comment pep:known chromosome:GRCm38:6:30089895:30151677:1 gene:ENSMUSG00000058440 transcript:ENSMUST00000167972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATTTHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNSEAAAHAVATLAE
ATLQGGGQIVLSGETAAAVGALTGVQDANGLVQIPVSMYQTVVTSLAQGNGPVQVAMAPV
TTRISDSAVTMDGQAVEVVTLEQ
Download sequence
Identical sequences A0A0G2KA43 A0A0P6J4K2 A0A1S2ZTD5 A0A1U7T1T0 A0A1U8CFG6 Q9WU00 S9X047 W5P3Q0
ENSMUSP00000110864 ENSMUSP00000110866 ENSMUSP00000110867 ENSMUSP00000130108 ENSOARP00000005052 ENSDNOP00000011065 NP_001157698.1.92730 NP_035068.3.92730 XP_004008105.1.66739 XP_004272253.1.21590 XP_004463291.1.11602 XP_004463293.1.11602 XP_004642803.1.9945 XP_004856404.1.39548 XP_004856405.1.39548 XP_004856406.1.39548 XP_004856407.1.39548 XP_005078145.1.91757 XP_005402474.1.28644 XP_005981488.1.78601 XP_006043465.1.26621 XP_006184772.1.101512 XP_006236260.1.100692 XP_006979467.1.50099 XP_007111538.1.24612 XP_007469769.1.90284 XP_007524256.1.11023 XP_007611759.1.69978 XP_007617458.1.28591 XP_008046882.1.4292 XP_010631797.1.5607 XP_010945846.1.22495 XP_010945847.1.22495 XP_010973951.1.51371 XP_010973952.1.51371 XP_011986834.1.54773 XP_012382526.1.11602 XP_012382527.1.11602 XP_012644656.1.48125 XP_012931959.1.39548 XP_012974566.1.91757 XP_012974567.1.91757 XP_012974568.1.91757 XP_013358733.1.28644 XP_013358734.1.28644 XP_013358735.1.28644 XP_013358736.1.28644 XP_013358737.1.28644 XP_013358738.1.28644 XP_014414777.1.101512 XP_015093111.1.17985 XP_015093112.1.17985 XP_016044094.1.11023 XP_017176933.1.92730 XP_017176934.1.92730 XP_017198181.1.1745 XP_017902421.1.57651 XP_019064402.1.5607 XP_019779714.1.83887 XP_020730316.1.74333 XP_021045134.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]