SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130168 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130168
Domain Number 1 Region: 14-103
Classification Level Classification E-value
Superfamily POZ domain 5.23e-19
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130168   Gene: ENSMUSG00000022106   Transcript: ENSMUST00000166875
Sequence length 119
Comment pep:putative chromosome:GRCm38:14:73173884:73182518:1 gene:ENSMUSG00000022106 transcript:ENSMUST00000166875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAVTWRLLSVEPDDHLTVAESLKREFDNPDTADLKFLVDGKYIYAHKVLLKIRCEHFRSS
LEDSEDDIVEMSEFSYPVFRAFLEYLYTDNISLSPEEAVGLRRVLLQVLHQPSDCSNTN
Download sequence
Identical sequences F6QHR6
ENSMUSP00000130168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]