SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131222 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131222
Domain Number 1 Region: 409-515
Classification Level Classification E-value
Superfamily POZ domain 1.43e-20
Family BTB/POZ domain 0.0082
Further Details:      
 
Domain Number 2 Region: 179-234,331-392
Classification Level Classification E-value
Superfamily POZ domain 3.14e-17
Family BTB/POZ domain 0.019
Further Details:      
 
Domain Number 3 Region: 11-154
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000632
Family G proteins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131222   Gene: ENSMUSG00000019944   Transcript: ENSMUST00000167384
Sequence length 633
Comment pep:novel chromosome:GRCm38:10:69212676:69289998:1 gene:ENSMUSG00000019944 transcript:ENSMUST00000167384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQLLATHVPTVWAIDQYR
VCQEVLERSRDVVDEVSISLRLWDTFGDHHKDRRFAYGRPIKRGDILPPEKGREVAKELG
IPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLKKVQKPLLQAPFLPPKAPPPV
IKVPECPSAGTSDAACLLDNPLCADVLFVLHDEEHIFAHRIYLATSSSKFYDLFLMECEE
SPCWGGGAGEEVPCRDFQGRTQSLGSAEEGKEGPQRTPQADPGASSGQDLPESLALQMEA
SGSEGHALSGWSKGFVSMHREVRVNPISKRVGPVTVVRLDPSMQSGPFRTLLRFLYSGQL
DEKEKDLLGLAQMAEVLEMFDLRMMVENIMNKEAFMNQEITKAFHVRKANRIKECLSKGT
FSDVTFTLDDGAISAHKPLLICSCEWMAAMFGGSFVESANREVHLPNINKMSMQAVLEYL
YTKQLSPNLDLDPLELIALANRFCLTHLVALVEQHAVQELTKAAVSGVSIDGEVLSYLEL
AQFHNANQLAAWCLHHICTNYNSVCSKFRKEIKSKSADNQEYFERHRWPPVWYLKEEDHY
QRVKREREKEDLALNKHHSRRKWCFWHSSPAVA
Download sequence
Identical sequences E9PZ72
ENSMUSP00000131222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]