SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131320 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131320
Domain Number 1 Region: 186-598
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.82e-89
Family Amylase, catalytic domain 0.000082
Further Details:      
 
Domain Number 2 Region: 599-697
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.6e-25
Family alpha-Amylases, C-terminal beta-sheet domain 0.0086
Further Details:      
 
Domain Number 3 Region: 69-181
Classification Level Classification E-value
Superfamily E set domains 2.6e-18
Family E-set domains of sugar-utilizing enzymes 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131320   Gene: ENSMUSG00000022707   Transcript: ENSMUST00000170464
Sequence length 702
Comment pep:known chromosome:GRCm38:16:70314134:70569714:1 gene:ENSMUSG00000022707 transcript:ENSMUST00000170464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAAPAAGETGPDARLEAALADVPELARLLEIDPYLKPFAADFQRRYKKFSQVLHDIG
ENEGGIDKFSRGYESFGIHRCSDGGIYCKEWAPGAEGVFLTGEFSGWNPFSHPYKKLEYG
KWELYIPPKQNKSPLIPHGSKLKVVITSKSGEILYRISPWAKYVVRENNNVNYDWIHWAP
EDPYKFKHSRPKKPRSLRIYESHVGISSHEGKIASYKHFTSNVLPRIKDLGYNCIQLMAI
MEHAYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGIVVLLDVVHSHASKNSEDGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFIYSSWEVLRFLLSNIRWWLEEYCFDGFRFDGVT
SMLYHHHGMGQGFSGDYNEYFGLQVDEDALIYLMLANHLAHTLYPDSITIAEDVSGMPAL
CSPTSQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGNIVYTLTNRRYLEKCVAYAESH
DQALVGDKTLAFWLMDAEMYTNMSVLAPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEERCGWLSAP
QAYVSEKHEANKTITFERAGLLFIFNFHPSKSYTDYRVGTATPGTFKIVLDSDAAEYGGH
QRLDHNTNYFAEAFEHNGRPYSLLVYIPSRVALILQNVDLQN
Download sequence
Identical sequences F6ZHD8
ENSMUSP00000131320 ENSMUSP00000023393 ENSMUSP00000131320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]