SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131514 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131514
Domain Number 1 Region: 10-191
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 5.23e-50
Family Isochorismatase-like hydrolases 0.0000977
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131514   Gene: ENSMUSG00000086784   Transcript: ENSMUST00000125249
Sequence length 206
Comment pep:known chromosome:GRCm38:7:4877053:4895717:1 gene:ENSMUSG00000086784 transcript:ENSMUST00000125249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARASLGRILPESSILFLCDLQEKFRPSIAYFPQIVSVAARMLKVARLLDVPILLTEQ
YPEGLGPTVPELGAQGIRPVSKTCFSMVPALQKELDGRSQLQSVLLCGIETQACILNTAL
DLLHRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLATSESLILQLVRDASHPQFKEI
QKIIKEPVPDSGLLSLFQGQSPLTSC
Download sequence
Identical sequences P85094
NP_001095068.1.92730 ENSMUSP00000131514 ENSMUSP00000131514 ENSMUSP00000131514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]