SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131788 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131788
Domain Number 1 Region: 122-242
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000000395
Family Glyoxalase I (lactoylglutathione lyase) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131788
Domain Number - Region: 17-110
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.059
Family Glyoxalase I (lactoylglutathione lyase) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131788   Gene: ENSMUSG00000017286   Transcript: ENSMUST00000170710
Sequence length 279
Comment pep:known chromosome:GRCm38:11:76221794:76243459:-1 gene:ENSMUSG00000017286 transcript:ENSMUST00000170710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MICGSVLNSPDVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGIGD
YKLGNDFMGITLASSQAVSNARKLEWPLSKVAEGIFETEAPGGYKFYLQDRSPSQSDPVL
KVTLAVSDLQKSLNYWSNLLGMKIYEQDEEKQRALLGYADNQCKLELQGIQGAVDHAAAF
GRIAFSCPQKELPDLEDLMKRESHSILTPLVSLDTPGKATVQVVILADPDGHEICFVGDE
AFRELSKMDPKGSKLLDDAMEADKSDEWFATRNKPKASG
Download sequence
Identical sequences XP_006534033.1.92730 ENSMUSP00000131788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]