SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132212 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132212
Domain Number 1 Region: 195-357
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-25
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000132212
Domain Number - Region: 373-491
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00236
Family Potassium channel NAD-binding domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132212   Gene: ENSMUSG00000058740   Transcript: ENSMUST00000171268
Sequence length 1218
Comment pep:known chromosome:GRCm38:2:25863854:25916117:1 gene:ENSMUSG00000058740 transcript:ENSMUST00000171268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDLDTEVLPLPPRYRFRDLLLGDQPFPNDDRLHVEDFSLDSSLSQVQVEFYVNENTFKE
RLKLFFIKNQRSSLRIRLFNFSLKLLTCLLYIVRVLLDNPDQGIGCWGCTKYNYTFNGSS
SEFHWAPILWVERKMALWVIQVIVATISFLETMLIIYLSYKGNIWEQIFHVSFVLEMINT
LPFIITVFWPPLRNLFIPVFLNCWLAKHALENMINDFHRAILRTQSAMFNQVLILFCTLL
CLVFTGTCGIQHLERAGGNLNLLTSFYFCIVTFSTVGFGDVTPKIWPSQLLVVILICVTL
VVLPLQFEELVYLWMERQKSGGNYSRHRARTEKHVVLCVSSLKIDLLMDFLNEFYAHPRL
QDYYVVILCPSEMDVQVRRVLQIPLWSQRVIYLQGSALKDQDLMRAKMDNGEACFILSSR
NEVDRTAADHQTILRAWAVKDFAPNCPLYVQILKPENKFHVKFADHVVCEEECKYAMLAL
NCICPATSTLITLLVHTSRGQEGQESPEQWQRTYGRCSGNEVYHIRMGDSKFFREYEGKS
FTYAAFHAHKKYGVCLIGLKREENKSILLNPGPRHILAASDTCFYINITKEENSAFIFKQ
EEKQKRRGLAGQALYEGPSRLPVHSIIASMGTVAMDLQNTDCRPSQGGSGGDGTKLTLPT
ENGSGSRRPSIAPVLELADSSALLPCDLLSDQSEDEVTPSDDEGLSVVEYVKGYPPNSPY
IGSSPTLCHLLPVKAPFCCLRLDKGCKHNSYEDAKAYGFKNKLIIVSAETAGNGLYNFIV
PLRAYYRSRRELNPIVLLLDNKPDHHFLEAICCFPMVYYMEGSVDNLDSLLQCGIIYADN
LVVVDKESTMSAEEDYMADAKTIVNVQTMFRLFPSLSITTELTHPSNMRFMQFRAKDSYS
LALSKLEKQERENGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMITITRLLLGLD
TTPGSGYLCAMKVTEDDLWIRTYGRLFQKLCSSSAEIPIGIYRTECHVFSEPHDVRAQSQ
ISVNMEDCEDTREAKGPWGTRAASGSGSTHGRHGGSADPVEHPLLRRKSLQWARKLSRKS
TKQAGKAPVATDWITQQRLSLYRRSERQELSELVKNRMKHLGLPTTGYEDVANLTASDVM
NRVNLGYLQDEMNDHHQNTLSYVLINPPPDTRLEPNDIVYLIRSDPLAHVASSSQSRKSS
CSNKLSSCNPETRDETQL
Download sequence
Identical sequences C0KTP6
ENSMUSP00000132212 NP_001138875.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]