SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132496 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132496
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000371
Family Glyoxalase I (lactoylglutathione lyase) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132496   Gene: ENSMUSG00000017286   Transcript: ENSMUST00000170017
Sequence length 61
Comment pep:known chromosome:GRCm38:11:76221607:76243651:-1 gene:ENSMUSG00000017286 transcript:ENSMUST00000170017 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MATRRALHFVFKVKNRFQTVHFFRDVLGMQVLRHEEFEEGCKAACNGIDIQLWHRRLQAW
Q
Download sequence
Identical sequences E9Q055
ENSMUSP00000132496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]