SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132809 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132809
Domain Number 1 Region: 403-534
Classification Level Classification E-value
Superfamily CalX-like 1.7e-37
Family CalX-beta domain 0.000000248
Further Details:      
 
Domain Number 2 Region: 534-712
Classification Level Classification E-value
Superfamily CalX-like 5.75e-31
Family CalX-beta domain 0.000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132809   Gene: ENSMUSG00000054640   Transcript: ENSMUST00000163123
Sequence length 958
Comment pep:known chromosome:GRCm38:17:81388691:81649607:-1 gene:ENSMUSG00000054640 transcript:ENSMUST00000163123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLSLPPNVSMGFRLVALVALLFSHVDHITADTEAETGGNETTECTGSYYCKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNGETT
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMFIII
ALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGVVEVWEGLLTFFFFP
ICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPASKTEIEMDGKVVNSHVDNF
LDGALVLEVDERDQDDEEARREMARILKELKQKHPEKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNMEMAENDPVSKIFFEQGTYQCLENCG
TVALTIMRRGGDLSTTVFVDFRTEDGTANAGSDYEFTEGTVIFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVRVSSDVSEDGILESNHASSIACLGSPSTATITIFDDDHAGIFTFE
EPVTHVSESIGIMEVKVLRTSGARGNVIIPYKTIEGTARGGGEDFEDTCGELEFQNDEIV
KTISVKVIDDEEYEKNKTFFIEIGEPRLVEMSEKKGGFTLTGQPIFRKVHARDHPIPSTV
ITISEEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESYEFKSTVDKLIKKTNL
ALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPT
EYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVPDTFASKV
AATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQFKVSPGTLAFSVTLFT
IFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSSLFVLLWLLYIFFSSLEAYCHIKGF
Download sequence
Identical sequences Q68FL0
NP_001106269.1.92730 XP_006524002.1.92730 ENSMUSP00000132809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]