SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133069 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133069
Domain Number 1 Region: 46-154
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 1.24e-27
Family Molybdopterin synthase subunit MoaE 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133069   Gene: ENSMUSG00000015536   Transcript: ENSMUST00000164737
Sequence length 157
Comment pep:known chromosome:GRCm38:13:114818287:114828544:1 gene:ENSMUSG00000015536 transcript:ENSMUST00000164737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISNSCFSPEMRLPSSRQSVEDNASEPSGKDVDDVQEKPKDIIQFTAEKLSVGEVS
QLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEALVPVSEASTVIAVSSAHRAASLEAVS
YAIDSLKAKVPIWKKEIYEESTSSWKRNKECFWAAGD
Download sequence
Identical sequences E9PVP5
NP_001106846.1.92730 ENSMUSP00000133069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]