SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133370 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133370
Domain Number 1 Region: 2-277
Classification Level Classification E-value
Superfamily ALDH-like 4.84e-98
Family ALDH-like 0.00000000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133370   Gene: ENSMUSG00000015134   Transcript: ENSMUST00000174701
Sequence length 277
Comment pep:putative chromosome:GRCm38:7:66402049:66419235:-1 gene:ENSMUSG00000015134 transcript:ENSMUST00000174701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDKAVEAAQAAFQRGSPWRRLDALSRGQLLHQLADLVERDRAILATLETMDTGKPFLHAF
FVDLEGCIKTFRYFAGWADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLAWK
LAPALCCGNTVVLKPAEQTPLTALYLASLIKEVGKLVREAASRSNLKRVTLELGGKNPCI
VCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKRPVGDPFD
AKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSA
Download sequence
Identical sequences G3UWP3
ENSMUSP00000133370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]